Cart summary

You have no items in your shopping cart.

Pomgnt1 Rabbit Polyclonal Antibody (FITC)

Pomgnt1 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2113917

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113917
CategoryAntibodies
DescriptionPomgnt1 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide corresponding to a region of Mouse
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW75kDa
UniProt IDQ91X88
Protein SequenceSynthetic peptide located within the following region: LLVTVIVNIKLILDTRRAISEANEDPEPEQDYDEALGRLESPRRRGSSPR
NCBINP_080927
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative names0610016I07Rik, 4930467B06Rik
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.