You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325408 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to POLRMT |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rat, Yeast |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human POLRMT |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 135kDa |
Target | POLRMT |
UniProt ID | O00411 |
Protein Sequence | Synthetic peptide located within the following region: ALGRDSVGAASVNLEPSDVPQDVYSGVAAQVEVFRRQDAQRGMRVAQVLE |
NCBI | NP_005026 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti APOLMT antibody, anti MTRNAP antibody, anti M Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Type: OVCAR-3 Whole Cell lysates, Antibody Dilution: 1.0 ug/mL, POLRMT is supported by BioGPS gene expression data to be expressed in OVCAR3.
Sample Tissue: Human A549 Whole Cell, Antibody Dilution: 1 ug/mL.
WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, WB | |
Human, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rat, Yeast | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Guinea pig, Human, Mouse, Rat, Yeast | |
Rabbit | |
Polyclonal | |
FITC |