You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb325943 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to POLM |
Target | POLM |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human POLM |
Protein Sequence | Synthetic peptide located within the following region: LRRFSRKEKGLWLNSHGLFDPEQKTFFQAASEEDIFRHLGLEYLPPEQRN |
UniProt ID | Q9NP87 |
MW | 55kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti Tdt-N antibody, anti Pol Mu antibody |
Note | For research use only |
NCBI | NP_037416 |
WB Suggested Anti-POLM Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
WB | |
Equine, Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |