You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577880 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to POLDIP3 |
Target | POLDIP3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Equine, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: LLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILKALFKSSGASVT |
UniProt ID | Q9BY77 |
MW | 43kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | SKAR, PDIP3, PDIP46 |
Note | For research use only |
NCBI | NP_835237 |
WB Suggested Anti-POLDIP3 Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell. POLDIP3 is supported by BioGPS gene expression data to be expressed in OVCAR3.
IH, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC, WB | |
Mouse, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |