You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2001336 |
---|---|
Category | Proteins |
Description | POLD1 Peptide - N-terminal region |
Predicted Reactivity | Human |
Form/Appearance | Lyophilized powder |
Buffer/Preservatives | Lyophilized powder |
Protein Sequence | Synthetic peptide located within the following region: DGKRRPGPGPGVPPKRARGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQ |
UniProt ID | P28340 |
MW | 124 kDa |
Tested applications | WB |
Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
Alternative names | CDC2, MDPL, POLD, CRCS10 |
Note | For research use only |
NCBI | NP_001243778.1 |