You have no items in your shopping cart.
Cart summary
POLD1 Peptide - N-terminal region
Catalog Number: orb2000250
| Catalog Number | orb2000250 |
|---|---|
| Category | Proteins |
| Description | POLD1 Peptide - N-terminal region |
| Predicted Reactivity | Human |
| Form/Appearance | Lyophilized powder |
| Buffer/Preservatives | Lyophilized powder |
| Protein Sequence | Synthetic peptide located within the following region: RGGLWDDDDAPRPSQFEEDLALMEEMEAEHRLQEQEEEELQSVLEGVADG |
| UniProt ID | P28340 |
| MW | 121 kDa |
| Application notes | This is a synthetic peptide designed for use in combination with POLD1 Rabbit Polyclonal Antibody (orb589556). It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings. |
| Storage | Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles. |
| Alternative names | CDC2, MDPL, POLD, CRCS10 |
| Note | For research use only |
| NCBI | NP_001243778.1 |
