SILV Rabbit Polyclonal Antibody

• Catalog Number: orb579883
• Category: Antibodies
• Description: Rabbit polyclonal antibody to SILV
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC-P, WB
• Predicted Reactivity: Bovine, Canine, Equine, Goat, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SILV
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 70kDa
• Target: PMEL
• UniProt ID: P40967
• Protein Sequence: Synthetic peptide located within the following region: HFLRNQPLTFALQLHDPSGYLAEADLSYTWDFGDSSGTLISRALVVTHTY
• NCBI: NP_008859
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: P1, SI, SIL, ME20, P100, SILV, ME20M, gp100, ME20-
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human MCF7, Antibody dilution: 1.0 ug/ml.

Human kidney

PMEL was immunoprecipitated from 1 mg HEK293 Whole Cell Lysate with orb579883 with 1:200 dilution. Western blot was performed using orb579883 at 1/1000 dilution, Lane 1: Control IP in HEK293 Whole Cell Lysate, Lane 2: PMEL IP with orb579883 in HEK293 Whole Cell Lysate, Lane 3: Input of HEK293 Whole Cell Lysate.

WB Suggested Anti-SILV Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate.