You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326533 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PLXNB3 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Guinea pig |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human PLXNB3 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 171kDa |
Target | PLXNB3 |
UniProt ID | B7Z3H9 |
Protein Sequence | Synthetic peptide located within the following region: DYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSKL |
NCBI | BAH12215 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | anti FLJ76953 antibody, anti PLEXB3 antibody, anti Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
Sample Tissue: Human Hela Whole Cell, Antibody Dilution: 3 ug/mL.
WB Suggested Anti-PLXNB3 Antibody, Titration: 1.0 ug/mL, Positive Control: Jurkat Whole Cell.
IF, IHC-Fr, IHC-P | |
Canine, Equine, Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Guinea pig, Human | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Guinea pig, Human | |
Rabbit | |
Polyclonal | |
Biotin |
IHC-Fr, IHC-P | |
Canine, Equine, Human, Porcine, Rat | |
Mouse | |
Rabbit | |
Polyclonal | |
HRP |