Cart summary

You have no items in your shopping cart.

PLSCR5 Rabbit Polyclonal Antibody (FITC)

PLSCR5 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2085201

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2085201
CategoryAntibodies
DescriptionPLSCR5 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityCanine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the C-terminal region of Human PLSCR5
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW30kDa
UniProt IDA0PG75
Protein SequenceSynthetic peptide located within the following region: SCWCPCYLQELEIQAPPGTIVGYVTQKWDPFLPKFTIQNANKEDILKIVG
NCBINP_001078889
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
NoteFor research use only
Expiration Date12 months from date of receipt.