Cart summary

You have no items in your shopping cart.

PLPP6 Rabbit Polyclonal Antibody (FITC)

PLPP6 Rabbit Polyclonal Antibody (FITC)

Catalog Number: orb2104209

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2104209
CategoryAntibodies
DescriptionPLPP6 Rabbit Polyclonal Antibody (FITC)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsWB
Predicted ReactivityBovine, Canine, Human, Mouse, Porcine, Rabbit, Rat
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PPAPDC2
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationFITC
MW32kDa
UniProt IDQ8IY26
Protein SequenceSynthetic peptide located within the following region: MPSPRRSMEGRPLGVSASSSSSSPGSPAHGGGGGGSRFEFQSLLSSRATA
NCBINP_982278
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPDP1, PSDP, PPAPDC2, bA6J24.6
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.