You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb585312 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PLPBP |
Target | PLPBP |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Guinea pig, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Protein Sequence | Synthetic peptide located within the following region: PADQVELSMGMSADFQHAVEVGSTNVRIGSTIFGERDYSKKPTPDKCAAD |
UniProt ID | O94903 |
MW | 30kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | PROSC, EPVB6D |
Note | For research use only |
NCBI | NP_009129 |
Sample Type: Human Kidney, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1.0 ug/ml, Peptide Concentration: 2.0 ug/ml, Lysate Quantity: 25 ug/lane.
WB Suggested Anti-PROSC Antibody, Titration: 1.0 ug/ml, Positive Control: Fetal Lung.
WB | |
Canine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Guinea pig, Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Biotin |