PLEKHJ1 Rabbit Polyclonal Antibody

SKU: orb585430

Description

PLEKHJ1 Rabbit Polyclonal Antibody is an unconjugated, affinity purified antibody targeting PLEKHJ1. It is suitable for WB and is reactive with human samples. Predicted reactivity includes Bovine, Canine, Equine, Mouse, Porcine, Rat, Yeast. This antibody is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Protein Biochemistry

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat, Yeast

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Target: PLEKHJ1
• Protein Sequence: Synthetic peptide located within the following region: YHFECSSEEQCQEWMEALRRASYEFMRRSLIFYRNEIRKVTGKDPLEQFG
• Molecular Weight: 16kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

GNRPX

Quick Database Links

Gene Symbol

PLEKHJ1

UniProt

Q9NW61

RefSeq (Protein):NP_060519