Cart summary

You have no items in your shopping cart.

PLEKHA7 Rabbit Polyclonal Antibody (Biotin)

PLEKHA7 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2107945

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2107945
CategoryAntibodies
DescriptionPLEKHA7 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityBovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PLEKHA7
Protein SequenceSynthetic peptide located within the following region: PESRYQTLPGRGLSGSTSRLQQSSTIAPYVTLRRGLNAESSKATFPRPKS
UniProt IDQ6IQ23
MW127kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesDKFZp686M22243
NoteFor research use only
NCBINP_778228