PLA2G5 Rabbit Polyclonal Antibody

• Catalog Number: orb578056
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PLA2G5
• Target: PLA2G5
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLA2G5
• Protein Sequence: Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW
• UniProt ID: P39877
• MW: 14kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: FRFB, GV-PLA2, PLA2-10, hVPLA(2)
• Note: For research use only
• NCBI: NP_000920

Rabbit Anti-PLA2G5 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Heart, Primary antibody Concentration: 10 ug/ml.

WB Suggested Anti-PLA2G5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: Human Thymus.