You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb576562 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PITX1 |
| Target | PITX1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Protein A purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PITX1 |
| Protein Sequence | Synthetic peptide located within the following region: GTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS |
| UniProt ID | P78337 |
| MW | 34kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | BFT, CCF, POTX, PTX1, LBNBG |
| Research Area | Cell Biology, Epigenetics & Chromatin, Stem Cell & Read more... |
| Note | For research use only |
| NCBI | NP_002644 |

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Positive control (+): Mouse Testis (M-TE), Negative control (-): Rat Brain (R-BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PITX1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.
WB | |
Bovine, Canine, Guinea pig, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, IF, IHC, IP, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
C. elegans, Drosophila, Mouse, Other, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Rat | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review