PITX1 Rabbit Polyclonal Antibody

• Catalog Number: orb576562
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PITX1
• Target: PITX1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PITX1
• Protein Sequence: Synthetic peptide located within the following region: GTPASPYSVYRDTCNSSLASLRLKSKQHSSFGYGGLQGPASGLNACQYNS
• UniProt ID: P78337
• MW: 34kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BFT, CCF, POTX, PTX1, LBNBG
• Research Area: Cell Biology, Epigenetics & Chromatin, Stem Cell &
• Note: For research use only
• NCBI: NP_002644

Sample Tissue: Mouse Spleen, Antibody Dilution: 1 ug/ml.

Positive control (+): Mouse Testis (M-TE), Negative control (-): Rat Brain (R-BR), Antibody concentration: 1 ug/ml.

WB Suggested Anti-PITX1 Antibody Titration: 1.25 ug/ml, ELISA Titer: 1:1562500, Positive Control: Jurkat cell lysate.