PINK1 antibody

• Catalog Number: orb331223
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PINK1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Animal, Bovine, Guinea pig, Human, Mouse, Rabbit, Rat
• Reactivity: Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 63 kDa
• Target: PINK1
• UniProt ID: Q9BXM7
• Protein Sequence: Synthetic peptide located within the following region: GCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP
• NCBI: NP_115785
• Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -2°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti BRPK antibody, anti FLJ27236 antibody, anti P
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

References

Sikora, Mateusz et al. Bone marrow stromal cells (BMSCs CD45- /CD44+ /CD73+ /CD90+ ) isolated from osteoporotic mice SAM/P6 as a novel model for osteoporosis investigation J Cell Mol Med, (2021)

PubMed: 34075722

Applications

WB

Reactivity

Mouse

Bourebaba, Lynda et al. The PTP1B inhibitor MSI-1436 ameliorates liver insulin sensitivity by modulating autophagy, ER stress and systemic inflammation in Equine metabolic syndrome affected horses Front Endocrinol (Lausanne), 14, 1149610 (2023)

PubMed: 37020593

Applications

WB

Reactivity

Equine

Western blot analysis of RPMI-8226 Whole Cell tissue using PINK1 antibody