PINK1 Rabbit Polyclonal Antibody

• Catalog Number: orb331223
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PINK1
• Target: PINK1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Protein Sequence: Synthetic peptide located within the following region: GCAGPCGRAVFLAFGLGLGLIEEKQAESRRAVSACQEIQAIFTQKSKPGP
• UniProt ID: Q9BXM7
• MW: 63 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: anti BRPK antibody, anti FLJ27236 antibody, anti P
• Research Area: Neuroscience
• Note: For research use only
• NCBI: NP_115785

References

Nabila Bourebaba 1, Justyna Domagała 2, Lynda Bourebaba 3 Revitalizing equine metabolism: how SHBG improves mitochondrial function and reduces inflammation BMC Vet Res, (2025)

PubMed: 41121214

Applications

WB

Reactivity

Equine

Sikora, Mateusz et al. Bone marrow stromal cells (BMSCs CD45- /CD44+ /CD73+ /CD90+ ) isolated from osteoporotic mice SAM/P6 as a novel model for osteoporosis investigation J Cell Mol Med, (2021)

PubMed: 34075722

Applications

WB

Reactivity

Mouse

Bourebaba, Lynda et al. The PTP1B inhibitor MSI-1436 ameliorates liver insulin sensitivity by modulating autophagy, ER stress and systemic inflammation in Equine metabolic syndrome affected horses Front Endocrinol (Lausanne), 14, 1149610 (2023)

PubMed: 37020593

Applications

WB

Reactivity

Equine

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/ml of the antibody was used in this experiment.

Rabbit Anti-PINK1 Antibody, Catalog Number: orb331223, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

Rabbit Anti-PINK1 Antibody, Catalog Number: orb331223, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: N/A, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PINK1 Antibody, Titration: 1.0 ug/ml, Positive Control: RPMI-8226 Whole Cell.