PIK3C2A Rabbit Polyclonal Antibody

• Catalog Number: orb331330
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PIK3C2A
• Target: PIK3C2A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Equine, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PIK3C2A
• Protein Sequence: Synthetic peptide located within the following region: PNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRE
• UniProt ID: O00443
• MW: 143kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: CPK, OCSKD, PI3-K-C2A, PI3K-C2alpha, PI3K-C2-alpha
• Note: For research use only
• NCBI: NP_002636.2

Sample Type: Hela Whole Cell lysates, Antibody dilution: 1.0 ug/ml.