Cart summary

You have no items in your shopping cart.

PIGV Rabbit Polyclonal Antibody (Biotin)

PIGV Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2115844

DispatchUsually dispatched within 5-10 working days
$ 620.00
Catalog Numberorb2115844
CategoryAntibodies
DescriptionPIGV Rabbit Polyclonal Antibody (Biotin)
Species/HostRabbit
ClonalityPolyclonal
Tested applicationsIHC, WB
Predicted ReactivityBovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PIGV
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
ConjugationBiotin
MW56kDa
UniProt IDQ9NUD9
Protein SequenceSynthetic peptide located within the following region: FVDQLVEGLLGGLSHWDAEHFLFIAEHGYLYEHNFAFFPGFPLALLVGTE
NCBINP_060307
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
Alternative namesPIG-V, HPMRS1, GPI-MT-II
Read more...
NoteFor research use only
Expiration Date12 months from date of receipt.