PIGF Rabbit Polyclonal Antibody

• Catalog Number: orb577568
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PIGF
• Target: PIGF
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Mouse, Porcine, Rat, Sheep
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIGF
• Protein Sequence: Synthetic peptide located within the following region: MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF
• UniProt ID: Q07326
• MW: 25kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: MGC32646, MGC33136
• Note: For research use only
• NCBI: NP_002634

Sample Tissue: Human 786-0 Whole Cell, Antibody Dilution: 1 ug/ml.

PIGF antibody - N-terminal region (orb577568), Catalog Number: orb577568, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PIGF Antibody Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.