You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb326013 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PI16 |
Target | PI16 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Canine, Equine, Porcine |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PI16 |
Protein Sequence | Synthetic peptide located within the following region: SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV |
UniProt ID | Q6UXB8 |
MW | 47kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti CRISP9 antibody, anti DKFZp586B1817 antibody, Read more... |
Note | For research use only |
NCBI | NP_699201 |
WB Suggested Anti-PI16 Antibody Titration: 0.2-1 ug/mL, ELISA Titer: 1:1562500, Positive Control: 721_B cell lysate.
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Canine, Equine, Human, Porcine | |
Rabbit | |
Polyclonal | |
Biotin |