You have no items in your shopping cart.
Description
Research Area
Images & Validation
−| Tested Applications | IHC, WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Human |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PHLDA2 |
| Target | PHLDA2 |
| Protein Sequence | Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT |
| Molecular Weight | 17kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PHLDA2 Rabbit Polyclonal Antibody [orb629887]
ELISA, WB
Human
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgPHLDA2 Rabbit Polyclonal Antibody [orb583928]
WB
Bovine, Equine, Guinea pig, Rat
Human
Rabbit
Polyclonal
Unconjugated
100 μlTSSC3 Rabbit Polyclonal Antibody (PE) [orb483931]
IF
Bovine, Equine, Gallus, Mouse, Porcine
Human, Rat
Rabbit
Polyclonal
PE
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Tissue: Human A172 Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-PHLDA2 Antibody, Catalog Number: orb583927, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic and membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PHLDA2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate. PHLDA2 is supported by BioGPS gene expression data to be expressed in HT1080.
Documents Download
Request a Document
Protocol Information
PHLDA2 Rabbit Polyclonal Antibody (orb583927)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review




