PHLDA2 Rabbit Polyclonal Antibody

• Catalog Number: orb583927
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHLDA2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Human
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PHLDA2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 17kDa
• Target: PHLDA2
• UniProt ID: Q53GA4
• Protein Sequence: Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT
• NCBI: NP_003302
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: IPL, BRW1C, BWR1C, HLDA2, TSSC3
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human A172 Whole Cell, Antibody dilution: 1 ug/ml.

Rabbit Anti-PHLDA2 Antibody, Catalog Number: orb583927, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasmic and membrane, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PHLDA2 Antibody Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate. PHLDA2 is supported by BioGPS gene expression data to be expressed in HT1080.