PHF21A Rabbit Polyclonal Antibody

• Catalog Number: orb577036
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHF21A
• Target: PHF21A
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Canine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PHF21A
• Protein Sequence: Synthetic peptide located within the following region: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK
• UniProt ID: Q96BD5
• MW: 70kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: BHC80, NEDMS, BM-006, IDDBCS
• Research Area: Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_057705
• Expiration Date: 12 months from date of receipt.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-PHF21A Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HT1080 cell lysate. PHF21A is supported by BioGPS gene expression data to be expressed in HT1080.