PHF20 Rabbit Polyclonal Antibody

• Catalog Number: orb575701
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PHF20
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Equine, Guinea pig, Porcine, Rabbit
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHF20
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 83kDa
• Target: PHF20
• UniProt ID: Q9BVI0
• Protein Sequence: Synthetic peptide located within the following region: GSALDDAVNPLHENGDDSLSPRLGWPLDQDRSKGDSDPKPGSPKVKEYVS
• NCBI: EAW76154
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: NZF, TZP, GLEA2, HCA58, TDRD20A, C20orf104
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Hela, Antibody Dilution: 1.0 ug/ml. PHF20 is strongly supported by BioGPS gene expression data to be expressed in HeLa.

Sample Type: 721_B, Antibody Dilution: 1.0 ug/ml. PHF20 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.

WB Suggested Anti-PHF20 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:2500, Positive Control: Jurkat cell lysate.