PHF19 Rabbit Polyclonal Antibody

SKU: orb581064

Description

Rabbit polyclonal antibody to PHF19

Research Area

Epigenetics & Chromatin

Images & Validation

• Tested Applications: WB
• Reactivity: Human
• Predicted Reactivity: Human

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PHF19
• Target: PHF19
• Protein Sequence: Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET
• Molecular Weight: 22kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PCL3, MTF2L1, TDRD19B

Lanes: 1. 30 ug control HEK-293T lysate, 2. 30 ug hPCL3L-FLAG transfected HEK-293T lysate, 3. 30 ug hPCL3L-MYC transfected HEK-293T lysate, 4. 30 ug hPCL3L-HA transfected HEK-293T lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: PHF19.

Lanes: 1. 30 ug HBEC lysate, 2. 30 ug A549 lysate, 3. 30 ug Calu-6 lysate, 4. 30 ug NCI358 lysate, 5. 30 ug NCI841 lysate, 6. 30 ug NCI1299 lysate, 7. 30 ug NCI1650 lysate, 8. 30 ug NCI1975 lysate, Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit HRP, Secondary Antibody dilution: 1:3000, Gene Name: PHF19.

WB Suggested Anti-PHF19 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

PHF19

UniProt

Q5T6S3

RefSeq (Protein):NP_001009936