Cart summary

You have no items in your shopping cart.

PFN1 Rabbit Polyclonal Antibody

SKU: orb580352

Description

Rabbit polyclonal antibody to PFN1

Research Area

Epigenetics & Chromatin, Molecular Biology, Protein Biochemistry

Images & Validation

Tested ApplicationsWB
ReactivityHuman, Mouse
Predicted ReactivityBovine, Equine, Guinea pig, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PFN1
TargetPFN1
Protein SequenceSynthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL
Molecular Weight15 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ALS18

Similar Products

  • Profilin 1/PFN1 Rabbit Polyclonal Antibody [orb234359]

    FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • Profilin 1 Rabbit Polyclonal Antibody [orb11300]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 200 μl, 100 μl
  • Profilin 1 Rabbit Polyclonal Antibody (FITC) [orb16252]

    FC,  IF

    Bovine, Canine, Equine

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    FITC

    100 μl
  • PFN1 Rabbit Polyclonal Antibody [orb630231]

    ELISA,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
  • PFN1 Rabbit Polyclonal Antibody [orb2955619]

    ELISA,  IHC,  WB

    Bovine, Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μg, 100 μg
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PFN1 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 10-20% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Canonical 15 kDa isoform is identified, and a second isoform of 18 kDa is also present in some samples.

PFN1 Rabbit Polyclonal Antibody

Lanes: 1. 20 ug human pregnant uterine muscle cells + hormone, 2. 20 ug human pregnant uterine muscle cells - hormone, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.

PFN1 Rabbit Polyclonal Antibody

Lanes: 1. 20 ug murine non-pregnant uteria tissue, 2. 20 ug murine non-laboring uterine tissue, 3. 20 ug murine laboring uterine tissue, 4. 20 ug murine preterm laboring uterine tissue, Primary Antibody dilution: 1:2000, Secondary Antibody: Goat anti-rabbit-Alexa Fluor 680, Secondary Antibody dilution: 1:25000, Gene Name: PFN1.

PFN1 Rabbit Polyclonal Antibody

Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Liver, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

PFN1 Rabbit Polyclonal Antibody

Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Spleen, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

PFN1 Rabbit Polyclonal Antibody

Rabbit Anti-PFN1 antibody, Formalin Fixed Paraffin Embedded Tissue: Human Tonsil, Primary antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20x, Exposure Time: 0.5-2.0 sec.

PFN1 Rabbit Polyclonal Antibody

WB Suggested Anti-PFN1 Antibody Titration: 0.2-1 ug/ml, Positive Control: Human Liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_005013

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PFN1 Rabbit Polyclonal Antibody (orb580352)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry