You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb583222 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PFKFB4 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PFKFB4 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 54kDa |
Target | PFKFB4 |
UniProt ID | Q16877 |
Protein Sequence | Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR |
NCBI | NP_004558 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PFKFB4 Antibody, Positive Control: Lane 1: 40 ug HEK293 lysate, Lane 2: 40 ug H1299 lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Goat anti-rabbit-HRP, Secondry Antibody dilution: 1:5000.
WB Suggested Anti-PFKFB4 Antibody, Positive Control: Lane 1: 10 ug human primary tumor lysate, Primary Antibody Dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondry Antibody dilution: 1:5000.
IHC-P, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Primate, Rat, Zebrafish | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Rabbit, Rat, Yeast, Zebrafish | |
Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |