You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb581676 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PFDN6 |
Species/Host | Rabbit |
Clonality | Polyclonal |
Tested applications | WB |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish |
Reactivity | Human |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PFDN6 |
Concentration | 0.5 mg/ml |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
MW | 14kDa |
Target | PFDN6 |
UniProt ID | O15212 |
Protein Sequence | Synthetic peptide located within the following region: MAELIQKKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALL |
NCBI | NP_055075 |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Alternative names | HKE2, KE-2, PFD6, H2-KE2 Read more... |
Note | For research use only |
Expiration Date | 12 months from date of receipt. |
WB Suggested Anti-PFDN6 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Transfected 293T.
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
HRP |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
FITC |
WB | |
Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Yeast, Zebrafish | |
Rabbit | |
Polyclonal | |
Biotin |
IHC, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |