You have no items in your shopping cart.
Cart summary
Item 1 of 1
PFDN1 Rabbit Polyclonal Antibody
Catalog Number: orb574482
| Catalog Number | orb574482 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PFDN1 |
| Target | PFDN1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 1.0 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PFDN1 |
| Protein Sequence | Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE |
| UniProt ID | O60925 |
| MW | 14kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | PDF, PFD1 |
| Note | For research use only |
| NCBI | NP_002613 |
WB Suggested Anti-PFDN1 Antibody Titration: 5.0-8.0 ug/ml, Positive Control: HepG2 cell lysate, PFDN1 is supported by BioGPS gene expression data to be expressed in HepG2.
- Item 1 of 4
PFDN1 Rabbit Polyclonal Antibody [orb312748]
IF, IHC-Fr, IHC-P, WB
Bovine, Canine, Equine, Gallus, Human, Rabbit, Sheep
Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 2
Anti-PFDN1 Antibody [orb256747]
IH, WB
Human, Mouse, Porcine, Rabbit, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 30 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 1
