PFDN1 Rabbit Polyclonal Antibody

• Catalog Number: orb574482
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PFDN1
• Target: PFDN1
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PFDN1
• Protein Sequence: Synthetic peptide located within the following region: MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTE
• UniProt ID: O60925
• MW: 14kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: PDF, PFD1
• Research Area: Cell Biology, Epigenetics & Chromatin
• Note: For research use only
• NCBI: NP_002613
• Expiration Date: 12 months from date of receipt.

WB Suggested Anti-PFDN1 Antibody Titration: 5.0-8.0 ug/ml, Positive Control: HepG2 cell lysate, PFDN1 is supported by BioGPS gene expression data to be expressed in HepG2.