PER2 Rabbit Polyclonal Antibody

• Catalog Number: orb577174
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PER2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Equine, Mouse, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PER2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 137 kDa
• Target: PER2
• UniProt ID: O15055
• Protein Sequence: Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ
• NCBI: NP_073728
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: FASPS, FASPS1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 137 kDa, 98 kDa and 80 kDa. The protein may be modified by phosphorylation and/or acetylation.

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/ml.

Sample Type: Hum. 721_B, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in 721_B.

Sample Type: Hum. Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. Fetal Lung, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Sample Type: Hum. MCF7, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in MCF7.

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in Jurkat.

WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.