Cart summary

You have no items in your shopping cart.

PER2 Rabbit Polyclonal Antibody

SKU: orb577174

Description

Rabbit polyclonal antibody to PER2

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsWB
ReactivityHuman
Predicted ReactivityEquine, Mouse, Rat

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PER2
TargetPER2
Protein SequenceSynthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ
Molecular Weight137 kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

FASPS, FASPS1

Similar Products

  • Per2 (phospho Ser662) rabbit pAb Antibody [orb770771]

    ELISA,  IF,  IHC,  WB

    Human, Mouse

    Polyclonal

    Unconjugated

    50 μl, 100 μl
  • PER2 Rabbit Polyclonal Antibody [orb500690]

    IF,  IHC-Fr,  IHC-P

    Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • Per2 rabbit pAb Antibody [orb770772]

    ELISA,  IF,  IHC

    Human, Mouse

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PER2 Rabbit Polyclonal Antibody [orb500606]

    IF,  IHC-Fr,  IHC-P

    Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • PER2 Rabbit Polyclonal Antibody [orb6695]

    IF,  IHC-Fr,  IHC-P

    Human

    Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PER2 Rabbit Polyclonal Antibody

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 137 kDa, 98 kDa and 80 kDa. The protein may be modified by phosphorylation and/or acetylation.

PER2 Rabbit Polyclonal Antibody

Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. 721_B, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in 721_B.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Adult Placenta, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Fetal Heart, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Fetal Lung, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Hum. MCF7, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in MCF7.

PER2 Rabbit Polyclonal Antibody

Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml.

PER2 Rabbit Polyclonal Antibody

Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in Jurkat.

PER2 Rabbit Polyclonal Antibody

WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_073728

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol

PER2 Rabbit Polyclonal Antibody (orb577174)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry