You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb577174 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PER2 |
Target | PER2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Equine, Mouse, Rat |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PER2 |
Protein Sequence | Synthetic peptide located within the following region: VAECVYCENKEKGNICIPYEEDIPSLGLSEVSDTKEDENGSPLNHRIEEQ |
UniProt ID | O15055 |
MW | 137 kDa |
Tested applications | WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FASPS, FASPS1 |
Note | For research use only |
NCBI | NP_073728 |
25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide is present in isoforms of 137 kDa, 98 kDa and 80 kDa. The protein may be modified by phosphorylation and/or acetylation.
Sample Tissue: Human THP-1 Whole Cell, Antibody Dilution: 2 ug/ml.
Sample Type: Hum. 721_B, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in 721_B.
Sample Type: Hum. Adult Placenta, Antibody Dilution: 1.0 ug/ml.
Sample Type: Hum. Fetal Heart, Antibody Dilution: 1.0 ug/ml.
Sample Type: Hum. Fetal Lung, Antibody Dilution: 1.0 ug/ml.
Sample Type: Hum. Fetal Muscle, Antibody Dilution: 1.0 ug/ml.
Sample Type: Hum. MCF7, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in MCF7.
Sample Type: Human Hela, Antibody Dilution: 1.0 ug/ml.
Sample Type: Human Jurkat, Antibody Dilution: 1.0 ug/ml. PER2 is supported by BioGPS gene expression data to be expressed in Jurkat.
WB Suggested Anti-PER2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:12500, Positive Control: Human Placenta.
ELISA, IHC-P, WB | |
Human, Mouse | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
IH, WB | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF, IHC-Fr, IHC-P | |
Human | |
Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |