Peptide YY (canine, mouse, porcine, rat)

• Catalog Number: orb2693573
• Category: Proteins
• Description: Peptide YY (pig) is a 36 amino acid gastrointestinal peptide, can be isolated from porcine duodenum. Peptide YY (pig) decreases appetite and food-intake by activation of the Y2 receptor. Peptide YY (pig) is present mainly in pancreatic endocrine cells with effect on both intestinal motility and the cardiovascular system.
• Target: Neuropeptide Y Receptor
• Purity: ≥95%
• Protein Sequence: YPAKPEAPGEDASPEELSRYYASLRHYLNLVTRQRY-NH2
• MW: 4240.7
• CAS Number: 81858-94-8
• Formula: C₁₉₀H₂₈₈N₅₄O₅₇
• Note: For research use only