You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693778 |
---|---|
Category | Proteins |
Description | Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion. |
Target | Neuropeptide Y Receptor |
Purity | ≥95% |
Protein Sequence | IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
MW | 4240.7 |
Solubility (25°C) | DMSO: 25 mg/mL |
CAS Number | 123583-37-9 |
Formula | C190H288N54O57 |
Note | For research use only |