Peptide YY (3-36) (canine, mouse, porcine, rat)

• Catalog Number: orb2693778
• Category: Proteins
• Description: Peptide YY (PYY) (3-36), Human is an endogenous appetite suppressing peptide. Peptide YY (PYY) (3-36), Human, a neuropeptide Y (NPY) Y2 receptor agonist, is a powerful inhibitor of intestinal secretion.
• CAS Number: 123583-37-9
• Purity: ≥95%
• MW: 4240.7
• Formula: C₁₉₀H₂₈₈N₅₄O₅₇
• Target: Neuropeptide Y Receptor
• Solubility (25°C): DMSO: 25 mg/mL
• Protein Sequence: IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
• Note: For research use only
• Expiration Date: 6 months from date of receipt.