You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
PDXK Rabbit Polyclonal Antibody
Catalog Number: orb582149
| Catalog Number | orb582149 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PDXK |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 34kDa |
| Target | PDXK |
| UniProt ID | O00764 |
| Protein Sequence | Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK |
| NCBI | NP_003672 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21o Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.
Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.
PDXK antibody - N-terminal region (orb582149), Catalog Number: orb582149, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
PDXK antibody - N-terminal region (orb582149), Catalog Number: orb582149, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PDXK Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.
- Item 1 of 2
Anti-Pyridoxal Kinase Antibody [orb341149]
IF, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
200 μl, 100 μl, 50 μl - Item 1 of 2
- Item 1 of 2
- Item 1 of 2
- Item 1 of 2
PDXK Rabbit Polyclonal Antibody [orb1954]
FC
Canine, Equine, Mouse, Rat
Human
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl
