PDXK Rabbit Polyclonal Antibody

SKU: orb582149

Description

Rabbit polyclonal antibody to PDXK

Research Area

Neuroscience

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDXK
• Target: PDXK
• Protein Sequence: Synthetic peptide located within the following region: PLQVLGFEIDAVNSVQFSNHTGYAHWKGQVLNSDELQELYEGLRLNNMNK
• Molecular Weight: 34kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

PKH, PNK, HMSN6C, PRED79, C21orf97, HEL-S-1a, C21orf124

Sample Type: Human Fetal Brain, Antibody dilution: 1.0 ug/ml.

Sample Type: Human Adult Placenta, Antibody dilution: 1.0 ug/ml.

PDXK antibody - N-terminal region (orb582149), Catalog Number: orb582149, Formalin Fixed Paraffin Embedded Tissue: Human Bronchial Epithelial Tissue, Observed Staining: Cytoplasm in Human Bronchial Epithelial Tissue, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

PDXK antibody - N-terminal region (orb582149), Catalog Number: orb582149, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PDXK Antibody Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.

Quick Database Links

Gene Symbol

PDXK

UniProt

O00764

RefSeq (Protein):NP_003672