PDLIM5 Rabbit Polyclonal Antibody

• Catalog Number: orb576835
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDLIM5
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM5
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 64kDa
• Target: PDLIM5
• UniProt ID: Q96HC4
• Protein Sequence: Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL
• NCBI: NP_006448
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: L9, ENH, LIM, ENH1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.