You have no items in your shopping cart.
PDLIM5 Rabbit Polyclonal Antibody
Description
Research Area
Images & Validation
−| Tested Applications | WB |
|---|---|
| Reactivity | Human |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat |
Key Properties
−| Host | Rabbit |
|---|---|
| Clonality | Polyclonal |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PDLIM5 |
| Target | PDLIM5 |
| Protein Sequence | Synthetic peptide located within the following region: SNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKAAQANVRIGDVVL |
| Molecular Weight | 64kDa |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
Storage & Handling
−| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
|---|---|
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−Similar Products
−PDLIM5 (phospho Tyr251) rabbit pAb Antibody [orb767394]
ELISA, IHC, WB
Human, Mouse, Rat
Polyclonal
Unconjugated
100 μl, 50 μlPDLIM5 Rabbit Polyclonal Antibody [orb629787]
ELISA, IHC, IP, WB
Human, Mouse, Rat
Rabbit
Polyclonal
Unconjugated
50 μg, 100 μgPDLIM5 Rabbit Polyclonal Antibody [orb575010]
IHC, WB
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
Human
Rabbit
Polyclonal
Unconjugated
100 μl

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Sample Type: HepG2, Antibody Dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.

Sample Type: HepG2, Lane A: Primary Antibody, Lane B: Primary Antibody + Blocking Peptide, Primary Antibody Concentration: 1 ug/ml, Peptide Concentration: 5.0 ug/ml, Lysate Quantity: 25 ug/lane/lane, Gel Concentration: 12%. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.

Sample Type: Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Brain, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Liver, Antibody Dilution: 1.0 ug/ml.

Sample Type: Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

WB Suggested Anti-PDLIM5 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: HepG2 cell lysate. There is BioGPS gene expression data showing that PDLIM5 is expressed in HepG2.
Documents Download
Request a Document
PDLIM5 Rabbit Polyclonal Antibody (orb576835)
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review











