Cart summary

You have no items in your shopping cart.

PDGFB Rabbit Polyclonal Antibody

SKU: orb584021

Description

Rabbit polyclonal antibody to PDGF B

Research Area

Cell Biology, Epigenetics & Chromatin, Signal Transduction

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Guinea pig, Mouse, Rat, Sheep

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human PDGFB
TargetPDGFB
Protein SequenceSynthetic peptide located within the following region: NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD
Molecular Weight27kDa
PurificationAffinity Purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration0.5 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

SIS, SSV, IBGC5, PDGF2, c-sis, PDGF-2

Similar Products

  • PDGFBB Rabbit Polyclonal Antibody [orb11255]

    IF,  IHC-Fr,  IHC-P,  WB

    Mouse, Rat

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PDGF-B rabbit pAb Antibody [orb769405]

    ELISA,  IF,  IHC,  WB

    Human, Mouse, Rat

    Polyclonal

    Unconjugated

    100 μl
  • PDGF-B Rabbit Polyclonal Antibody [orb11254]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Canine, Equine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl, 200 μl
  • PDGF-A Rabbit Polyclonal Antibody (PE) [orb485787]

    FC,  IF

    Rabbit, Rat

    Human, Mouse

    Rabbit

    Polyclonal

    PE

    100 μl
  • PDGFAA + PDGFBB Rabbit Polyclonal Antibody [orb158129]

    IF,  IHC-Fr,  IHC-P

    Bovine, Canine, Equine, Gallus, Mouse, Porcine, Rabbit

    Human, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PDGFB Rabbit Polyclonal Antibody

Sample Tissue: Human A549 Whole Cell, Antibody dilution: 1 ug/ml.

PDGFB Rabbit Polyclonal Antibody

Sample Tissue: Human MCF7 Whole Cell, Antibody dilution: 1 ug/ml.

PDGFB Rabbit Polyclonal Antibody

Immunohistochemistry with Uterus tissue at an antibody concentration of 5 ug/ml using anti-PDGFB antibody (orb584021).

PDGFB Rabbit Polyclonal Antibody

Rabbit Anti-PDGFB Antibody, Catalog Number: orb584021, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec, Protocol located in Reviews and Data.

PDGFB Rabbit Polyclonal Antibody

Surface Plasmon Resonance Kinetic Characterization of Polyclonal Antibody Affinity. Purified polyclonal antibodies were immobilized on a Protein A/G coated Carterra LSA sensor chip (PAGH200M) at concentrations of 5, and 50 ug/ml in duplicate. Antibodies on the surface were exposed to interaction with peptides sequentially via microfluidic controlled flow at 333nM peptide concentration for kinetic characterization of the binders for affinity and specificity, followed by curve fitting using the Kinetics software. Kd determinations for both concentrations were averaged and results and standard deviation are shown.

PDGFB Rabbit Polyclonal Antibody

WB Suggested Anti-PDGFB Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate. There is BioGPS gene expression data showing that PDGFB is expressed in HEK293T.

PDGFB Rabbit Polyclonal Antibody

WB Suggested Anti-PDGFB antibody Titration: 1 ug/ml, Sample Type: Human liver.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002599

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PDGFB Rabbit Polyclonal Antibody (orb584021)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 600.00
DispatchUsually dispatched within 3-7 working days
Bulk Enquiry