PDE9A Rabbit Polyclonal Antibody

• Catalog Number: orb579570
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDE9A
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDE9A
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 61kDa
• Target: PDE9A
• UniProt ID: O76083
• Protein Sequence: Synthetic peptide located within the following region: SDIKKMREELAARSSRTNCPCKYSFLDNHKKLTPRRDVPTYPKYLLSPET
• NCBI: NP_001001581
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: HSPDE9A2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Tissue: Human Hela Whole Cell, Antibody dilution: 1 ug/ml.

Human kidney

Sample Type: Lane 1: 5 ug in vitro translation without DNA, Lane 2: 5 ug in vitro translation hNeur1-pcDNA3, Lane 3: 60 ug in vitro translation rNeur1-pcDNA3, Lane 4: 60 ug HEK293 cell lysate (not transfected), Lane 5: 60 ug hNeur1-pcDNA3 overexpressed in HEK293 cells, Lane 6: 60 ug rNeur1-pcDNA3 overexpressed in HEK293 cells. Primary Antibody dilution: 1:1000, Secondary Antibody: Anti-rabbit-HRP, Secondary Antibody dilution: 1:5000, Color/Signal Descriptions: PDE9A.

WB Suggested Anti-PDE9A Antibody Titration: 1.0 ug/ml, Positive Control: Jurkat cell lysate.

WB Suggested Anti-PDE9A Antibody Titration: 5% Milk, ELISA Titer: dilution: 1:500, Positive Control: Mouse Brain lysate.