You have no items in your shopping cart.
Cart summary
Item 1 of 1
PDE6C Rabbit Polyclonal Antibody
Catalog Number: orb586020
Product Properties
| Catalog Number | orb586020 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PDE6C |
| Target | PDE6C |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Human |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Protein Sequence | Synthetic peptide located within the following region: LQNNRVEWKSLADEYDAKMKVIEEEAKKQEGGAEKAAEDSGGGDDKKSKT |
| UniProt ID | P51160 |
| MW | 99kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | COD4, ACHM5, PDEA2 |
| Research Area | Epigenetics |
| Note | For research use only |
| NCBI | NP_006195 |
Images
WB Suggested Anti-PDE6C Antibody, Titration: 1.0 ug/ml, Positive Control: OVCAR-3 Whole Cell. PDE6C is supported by BioGPS gene expression data to be expressed in OVCAR3.
Similar Products
- Item 1 of 1
Reviews
PDE6C Rabbit Polyclonal Antibody (orb586020)
- 0.0
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review