PDE3B Rabbit Polyclonal Antibody

• Catalog Number: orb579140
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PDE3B
• Target: PDE3B
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDE3B
• Protein Sequence: Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN
• UniProt ID: Q13370
• MW: 124 kDa
• Tested applications: WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: HcGIP1, cGIPDE1
• Note: For research use only
• NCBI: NP_000913

25 ug of the indicated Human whole cell extracts was loaded onto a 6-18% SDS-PAGE gel. 1 ug/ml of the antibody was used in this experiment. Protein may be modified by phosphorylation.

WB Suggested Anti-PDE3B Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: 293T cell lysate.