PCYOX1 Rabbit Polyclonal Antibody

• Catalog Number: orb574476
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCYOX1
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Porcine, Rabbit, Yeast
• Reactivity: Human
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCYOX1
• Concentration: 1.0 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 57kDa
• Target: PCYOX1
• UniProt ID: Q9UHG3
• Protein Sequence: Synthetic peptide located within the following region: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY
• NCBI: NP_057381
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: PCL1
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Human Liver

Rabbit Anti-PCYOX1 Antibody, Paraffin Embedded Tissue: Human alveolar cell, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

WB Suggested Anti-PCYOX1 Antibody Titration: 0.5 ug/ml, Positive Control: Jurkat cell lysate.