Queen's Award Received in 2021 ISO 9001 Certified Delivered over 1,000,000 bio-reagents to life science researchers Trusted by Life Science Communities
Cart summary

You have no items in your shopping cart.

PCNA Rabbit Polyclonal Antibody

SKU: orb592693

Description

PCNA Rabbit Polyclonal Antibody is an unconjugated, Protein A purified antibody for the detection of PCNA. It is suitable for IHC, WB applications. The immunogen is a synthetic peptide directed towards the C terminal region of human PCNA. This antibody reacts with Human samples and is predicted to react with Bovine, Canine, Mouse, Rat, Zebrafish. It is supplied as a liquid in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Research Area

Epigenetics & Chromatin

Images & Validation

Tested ApplicationsIHC, WB
ReactivityHuman
Predicted ReactivityBovine, Canine, Mouse, Rat, Zebrafish

Related Conjugates & Formulations

Key Properties

HostRabbit
ClonalityPolyclonal
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human PCNA
TargetPCNA
Protein SequenceSynthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
Molecular Weight29kDa
PurificationProtein A purified
ConjugationUnconjugated

Storage & Handling

StorageMaintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration1.0 mg/ml
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

ATLD2

Similar Products

  • PCNA Rabbit Polyclonal Antibody [orb11250]

    FC,  IF,  IHC-Fr,  IHC-P,  WB

    Bovine, Rabbit, Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    50 μl, 100 μl, 200 μl
  • PCNA Rabbit Polyclonal Antibody [orb2563530]

    IF,  IHC-Fr,  IHC-P,  WB

    Sheep

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 200 μl, 50 μl
  • PCNA Rabbit Polyclonal Antibody [orb570401]

    ELISA,  FC,  ICC,  IF,  IHC,  WB

    Human, Mouse, Rat

    Rabbit

    Polyclonal

    Unconjugated

    100 μg
  • PCNA Antibody (C-term) [orb1931414]

    IF,  IHC-P,  WB

    Hamster, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    100 μl, 50 μl
  • PCNA Antibody (Center) [orb1931413]

    FC,  IF,  IHC-P,  WB

    Hamster, Mouse, Rat

    Human

    Rabbit

    Polyclonal

    Unconjugated

    400 μl
Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

PCNA Rabbit Polyclonal Antibody

NT2 cells were pretreated with 2N HCL for 30 minutes, Washed 3x in PBS, Stained for 2 hours with 1 ug/50 ul antibody, and Incubated in Alexa goat-rabbit 594 for 1 H. Antibody: Red, DAPI: Blue.

PCNA Rabbit Polyclonal Antibody

Rabbit Anti-PCNA Antibody, Paraffin Embedded Tissue: Human Spleen, Cellular Data: Spleen cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

PCNA Rabbit Polyclonal Antibody

Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

PCNA Rabbit Polyclonal Antibody

Sample Type: 1. Human NT-2 cells (60 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.

PCNA Rabbit Polyclonal Antibody

WB Suggested Anti-PCNA Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. PCNA is supported by BioGPS gene expression data to be expressed in HepG2.

UniProt Details

No UniProt data available

NCBI Reference Sequences

Associated Accession Numbers
Curated reference sequences for the gene transcript and protein product
ProteinNP_002583

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

WB
Western Blot (IB, immunoblot)
View Protocol
IHC
Immunohistochemistry
View Protocol

PCNA Rabbit Polyclonal Antibody (orb592693)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

100 μl
$ 550.00
Free Secondary Antibody (20 ul)0/0

Please add an antibody product to your cart first.

DispatchUsually dispatched within 3-7 working days
Bulk Enquiry