PCNA Rabbit Polyclonal Antibody

• Catalog Number: orb592693
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PCNA
• Target: PCNA
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Mouse, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 1.0 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Protein A purified
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PCNA
• Protein Sequence: Synthetic peptide located within the following region: LNFFTKATPLSSTVTLSMSADVPLVVEYKIADMGHLKYYLAPKIEDEEGS
• UniProt ID: P12004
• MW: 29kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ATLD2
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_002583
• Expiration Date: 12 months from date of receipt.

NT2 cells were pretreated with 2N HCL for 30 minutes, Washed 3x in PBS, Stained for 2 hours with 1 ug/50 ul antibody, and Incubated in Alexa goat-rabbit 594 for 1 H. Antibody: Red, DAPI: Blue.

Rabbit Anti-PCNA Antibody, Paraffin Embedded Tissue: Human Spleen, Cellular Data: Spleen cells, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.

Application: IHC, Species+tissue/cell type: Human brain stem cells, Primary antibody dilution: 1:500, Secondary antibody: Goat anti-rabbit Alexa-Fluor 594, Secondary antibody dilution: 1:1000.

Sample Type: 1. Human NT-2 cells (60 ug), Primary antibody dilution: 2 ug/ml, Secondary antibody: IRDye 800CW goat anti-rabbit, Secondary antibody dilution: 1:20000.

WB Suggested Anti-PCNA Antibody Titration: 1.25 ug/ml, Positive Control: HepG2 cell lysate. PCNA is supported by BioGPS gene expression data to be expressed in HepG2.