Cart summary

You have no items in your shopping cart.

PCDHB13 Rabbit Polyclonal Antibody (Biotin)

PCDHB13 Rabbit Polyclonal Antibody (Biotin)

Catalog Number: orb2113219

DispatchUsually dispatched within 5-10 working days
$ 680.00
Catalog Numberorb2113219
CategoryAntibodies
DescriptionPCDHB13 Rabbit Polyclonal Antibody (Biotin)
ClonalityPolyclonal
Species/HostRabbit
ConjugationBiotin
Predicted ReactivityHuman
Form/AppearanceLiquid. Purified antibody supplied in 1x PBS buffer.
Buffer/PreservativesLiquid. Purified antibody supplied in 1x PBS buffer.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human PCDHB13
Protein SequenceSynthetic peptide located within the following region: GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI
UniProt IDQ9Y5F0
MW85kDa
Tested applicationsWB
StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Alternative namesPCDH-BETA13
NoteFor research use only
NCBINP_061756