You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb574360 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAX3 |
Target | PAX3 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Mouse |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PAX3 |
Protein Sequence | Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC |
UniProt ID | P23760 |
MW | 53kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | WS1, WS3, CDHS, HUP2 |
Note | For research use only |
NCBI | NP_852122 |
Sample Type: Mouse B16F10, Primary Antibody dilution: 1:200, Secondary Antibody: Goat anti-rabbit-FITC, Secondary Antibody dilution: 1:800, Color/Signal Descriptions: Green: FITC Blue: DAPI, Gene Name: PAX3.
WB Suggested Anti-PAX3 Antibody, Positive Control: Lane 1: Flag-PAX3(overexpression, human), HEK293, 50?g, Lane 2: Mouse, B16F10, 50?g, Lane 3: Human, A375, 50?g. Lane 4: Human, A2058, 50?g, Primary Antibody Dilution: 1:5000, Secondary Antibody: Goat anti-rabbit AP, Secondry Antibody Dilution: 1:5000.
WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Lung.
IF, IHC-Fr, IHC-P, WB | |
Mouse, Rat | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Yeast | |
Human, Mouse | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IHC-P, WB | |
Mouse | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |