PAX3 Rabbit Polyclonal Antibody

• Catalog Number: orb574360
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PAX3
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: IHC, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Reactivity: Human, Mouse
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human PAX3
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 53kDa
• Target: PAX3
• UniProt ID: P23760
• Protein Sequence: Synthetic peptide located within the following region: GGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYC
• NCBI: NP_852122
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: WS1, WS3, CDHS, HUP2
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: Mouse B16F10, Primary Antibody dilution: 1:200, Secondary Antibody: Goat anti-rabbit-FITC, Secondary Antibody dilution: 1:800, Color/Signal Descriptions: Green: FITC Blue: DAPI, Gene Name: PAX3.

WB Suggested Anti-PAX3 Antibody, Positive Control: Lane 1: Flag-PAX3(overexpression, human), HEK293, 50?g, Lane 2: Mouse, B16F10, 50?g, Lane 3: Human, A375, 50?g. Lane 4: Human, A2058, 50?g, Primary Antibody Dilution: 1:5000, Secondary Antibody: Goat anti-rabbit AP, Secondry Antibody Dilution: 1:5000.

WB Suggested Anti-PAX3 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: Human Lung.