You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb592908 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PAX2 |
Target | PAX2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human |
Predicted Reactivity | Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PAX2 |
Protein Sequence | Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR |
UniProt ID | Q02962 |
MW | 45kDa |
Tested applications | IHC, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | FSGS7, PAPRS |
Note | For research use only |
NCBI | NP_000269 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment. The peptide sequence is present in multiple isoforms from 42 kDa to 45 kDa.
Sample Tissue: Human Ovary Tumor, Antibody Dilution: 1 ug/ml.
Rabbit Anti-PAX2 Antibody, Paraffin Embedded Tissue: Human Kidney, Cellular Data: Epithelial cells of renal tubule, Antibody Concentration: 4.0-8.0 ug/ml, Magnification: 400X.
WB Suggested Anti- Antibody Titration: 1.0 ug/ml, Positive Control: MCF-7 whole cell lysates.
IHC, WB | |
Bovine, Canine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Sheep, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
FC, IF, IHC-Fr, IHC-P, WB | |
Bovine, Canine, Equine, Gallus, Porcine, Rabbit, Sheep | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |