You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb329744 |
---|---|
Category | Antibodies |
Description | Rabbit polyclonal antibody to PARP2 |
Target | PARP2 |
Clonality | Polyclonal |
Species/Host | Rabbit |
Conjugation | Unconjugated |
Reactivity | Human, Rat |
Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit |
Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | 0.5 mg/ml |
Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PARP2 |
Protein Sequence | Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA |
UniProt ID | Q9UGN5 |
MW | 66 kDa |
Tested applications | ICC, IF, WB |
Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Alternative names | anti ADPRT2 antibody, anti PARP-2 antibody, anti A Read more... |
Note | For research use only |
NCBI | NP_005475 |
25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The peptide is within isoform at 66 kDa, 65 kDa, and 58 kDa, also modified by phosphorylation.
Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.
Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.
Sample Type: Rat thyrocytes-FRTL-5, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Texas Red, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Red: PARP2 Blue: DAPI, Gene Name: PARP2.
WB Suggested Anti-PARP2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Raji cell lysate, PARP2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |