PARP2 Rabbit Polyclonal Antibody

• Catalog Number: orb329744
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PARP2
• Species/Host: Rabbit
• Clonality: Polyclonal
• Tested applications: ICC, IF, WB
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit
• Reactivity: Human, Rat
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PARP2
• Concentration: 0.5 mg/ml
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• MW: 66 kDa
• Target: PARP2
• UniProt ID: Q9UGN5
• Protein Sequence: Synthetic peptide located within the following region: LLDLFEVEKDGEKEAFREDLHNRMLLWHGSRMSNWVGILSHGLRIAHPEA
• NCBI: NP_005475
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Alternative names: anti ADPRT2 antibody, anti PARP-2 antibody, anti A
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 0.5 ug/mL of the antibody was used in this experiment. The peptide is within isoform at 66 kDa, 65 kDa, and 58 kDa, also modified by phosphorylation.

Sample Tissue: Human Hela, Antibody Dilution: 1.0 ug/mL.

Sample Tissue: Human Jurkat Whole Cell, Antibody Dilution: 3 ug/mL.

Sample Type: Rat thyrocytes-FRTL-5, Primary Antibody Dilution: 1:100, Secondary Antibody: Anti-rabbit-Texas Red, Secondary Antibody Dilution: 1:100, Color/Signal Descriptions: Red: PARP2 Blue: DAPI, Gene Name: PARP2.

WB Suggested Anti-PARP2 Antibody Titration: 0.2-1 ug/mL, Positive Control: Raji cell lysate, PARP2 is strongly supported by BioGPS gene expression data to be expressed in Human Raji cells.