PARP16 Rabbit Polyclonal Antibody

• Catalog Number: orb574809
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PARP16
• Target: PARP16
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Mouse, Porcine, Rabbit, Rat
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PARP16
• Protein Sequence: Synthetic peptide located within the following region: PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL
• UniProt ID: Q8N5Y8
• MW: 36 kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: ARTD15, pART15, C15orf30
• Research Area: Cell Biology, Epigenetics & Chromatin, Molecular B
• Note: For research use only
• NCBI: NP_060321
• Expiration Date: 12 months from date of receipt.

25 ug of the indicated Human whole cell extracts was loaded onto a 12% SDS-PAGE gel. 3 ug/ml of the antibody was used in this experiment.

Sample Tissue: Human 293T, Antibody dilution: 1.0 ug/ml.

Sample Type: 293T, Antibody dilution: 1.0 ug/ml. PARP16 is supported by BioGPS gene expression data to be expressed in HEK293T.

Positive control (+): Human Ovary (OV), Negative control (-): Human stomach (ST), Antibody concentration: 1 ug/ml.

Rabbit Anti-PARP16 Antibody, Catalog Number: orb574809, Formalin Fixed Paraffin Embedded Tissue: Human Adult heart, Observed Staining: Cytoplasmic, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate. PARP16 is supported by BioGPS gene expression data to be expressed in HEK293T.