Pard6b Rabbit Polyclonal Antibody

SKU: orb578646

Description

Rabbit polyclonal antibody to Pard6b

Research Area

Cell Biology, Signal Transduction

Images & Validation

• Tested Applications: IHC, WB
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish

Key Properties

• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Pard6b
• Target: Pard6b
• Protein Sequence: Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
• Molecular Weight: 40kDa
• Purification: Affinity Purified
• Conjugation: Unconjugated

Storage & Handling

• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Expiration Date: 12 months from date of receipt.
• Disclaimer: For research use only

Alternative Names

Par6b, AV025615

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Type: Mouse Heart lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-Pard6b Antibody, Catalog Number: orb578646, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Pard6b antibody Titration: 1 ug/ml, Sample Type: Human liver.

Quick Database Links

Gene Symbol

Pard6b

UniProt

Q9JK83

RefSeq (Protein):NP_067384