Pard6b Rabbit Polyclonal Antibody

• Catalog Number: orb578646
• Category: Antibodies
• Description: Rabbit polyclonal antibody to Pard6b
• Target: Pard6b
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human, Mouse
• Predicted Reactivity: Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity Purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of MOUSE Pard6b
• Protein Sequence: Synthetic peptide located within the following region: SKFGAEFRRFSLERSKPGKFEEFYGLLQHVHKIPNVDVLVGYADIHGDLL
• UniProt ID: Q9JK83
• MW: 40kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Par6b, AV025615
• Research Area: Cell Biology, Signal Transduction
• Note: For research use only
• NCBI: NP_067384

Sample Tissue: Mouse Heart, Antibody Dilution: 1 ug/ml.

Sample Type: Mouse Heart lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-Pard6b Antibody, Catalog Number: orb578646, Formalin Fixed Paraffin Embedded Tissue: Human Adult liver, Observed Staining: Cytoplasmic, Membrane, Primary Antibody Concentration: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy2/3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-Pard6b antibody Titration: 1 ug/ml, Sample Type: Human liver.