You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb578643 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PARD3 |
| Target | PARD3 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human |
| Predicted Reactivity | Bovine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARD3 |
| Protein Sequence | Synthetic peptide located within the following region: LEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS |
| UniProt ID | Q8TEW0 |
| MW | 110kDa |
| Tested applications | IHC, WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | Baz, ASIP, PAR3, PARD-3, PARD3A, SE2-5T2, PPP1R118 Read more... |
| Research Area | Cell Biology, Epigenetics & Chromatin, Immunology Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |

Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-PARD3 Antibody, Catalog Number: orb578643, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane in intercalated disc, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
ELISA, IF, IHC-P, WB | |
Human, Mouse, Rat | |
Polyclonal | |
Unconjugated |
ELISA, FC, IHC, IP, WB | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
ELISA, WB | |
Bovine, Canine, Gallus, Mouse, Porcine, Rabbit, Rat | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IHC, WB | |
Guinea pig | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review