PARD3 Rabbit Polyclonal Antibody

• Catalog Number: orb578643
• Category: Antibodies
• Description: Rabbit polyclonal antibody to PARD3
• Target: PARD3
• Clonality: Polyclonal
• Species/Host: Rabbit
• Conjugation: Unconjugated
• Reactivity: Human
• Predicted Reactivity: Bovine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish
• Form/Appearance: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Concentration: 0.5 mg/ml
• Buffer/Preservatives: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Purification: Affinity purified
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human PARD3
• Protein Sequence: Synthetic peptide located within the following region: LEHGDGGILDLDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQS
• UniProt ID: Q8TEW0
• MW: 110kDa
• Tested applications: IHC, WB
• Storage: Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles.
• Alternative names: Baz, ASIP, PAR3, PARD-3, PARD3A, SE2-5T2, PPP1R118
• Research Area: Cell Biology, Epigenetics & Chromatin, Immunology
• Note: For research use only
• Expiration Date: 12 months from date of receipt.

Sample Type: PANC1 Whole Cell lysates, Antibody Dilution: 1.0 ug/ml.

Rabbit Anti-PARD3 Antibody, Catalog Number: orb578643, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, plasma membrane in intercalated disc, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.