You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb2693904 |
---|---|
Category | Proteins |
Description | Parathyroid hormone (1-34) (rat) is a parathyroid hormone. Parathyroid hormone (1-34) (rat) improves both cortical and cancellous bone structure. Parathyroid hormone (1-34) (rat) can be used for the research of osteoporosis. |
Target | Thyroid Hormone Receptor |
Purity | ≥95% |
Protein Sequence | AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF |
MW | 4057.8 |
CAS Number | 98614-76-7 |
Formula | C180H291N55O48S2 |
Note | For research use only |
≥95% | |
112540-82-6 | |
4017.65 | |
C180H287N57O48 |
> 95% by hplc | |
4057.74 Da | |
H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |