Cart summary

You have no items in your shopping cart.

Parathyroid hormone (1-34) (rat)

SKU: orb1147058

Description

Parathyroid hormone (PTH) receptor agonist; Peptides.

Research Area

Metabolism Research

Images & Validation

Key Properties

Molecular Weight4057.74 Da
Protein SequenceH-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
Purity> 95% by hplc

Storage & Handling

StorageStore dry, frozen and in the dark
Form/AppearanceFreeze dried solid
Expiration Date12 months from date of receipt.
DisclaimerFor research use only

Alternative Names

98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFPT 040, PT-040, PT040, Parathyroid hormone (1-34) (rat), pTH (1-34) (rat)

Similar Products

Quality Guarantee

Quality Guarantee

Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].

Documents Download

Datasheet
Product Information
Download

Request a Document

Protocol Information

Parathyroid hormone (1-34) (rat) (orb1147058)

  • Star
  • Star
  • Star
  • Star
  • Star
  • 0.0
Based on 0 reviews

Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.

Login to Submit a Review

No reviews yet

Available Sizes

Select a size below

1 mg
$ 330.00
DispatchUsually dispatched within 5-10 working days
Bulk Enquiry