You have no items in your shopping cart.
You have no items in your shopping cart.
Catalog Number | orb1147058 |
---|---|
Category | Proteins |
Description | Parathyroid hormone (PTH) receptor agonist; Peptides. |
Form/Appearance | Freeze dried solid |
Purity | > 95% by hplc |
Protein Sequence | H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
MW | 4057.74 Da |
H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH | |
None | |
Parathyroid hormone receptors | |
Solubility (25°C) | Soluble to 1 mg/ml in water |
CAS Number | 98614-76-7 |
Formula | C180H291N55O48S2 |
Storage | Store dry, frozen and in the dark |
Alternative names | 98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFPT 0 Read more... |
Note | For research use only |
≥95% | |
112540-82-6 | |
4017.65 | |
C180H287N57O48 |