You have no items in your shopping cart.
Parathyroid hormone (1-34) (rat)
SKU: orb1147058
Description
Research Area
Metabolism Research
Images & Validation
−
Key Properties
−| Molecular Weight | 4057.74 Da |
|---|---|
| Protein Sequence | H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH |
| Purity | > 95% by hplc |
Storage & Handling
−| Storage | Store dry, frozen and in the dark |
|---|---|
| Form/Appearance | Freeze dried solid |
| Expiration Date | 12 months from date of receipt. |
| Disclaimer | For research use only |
Alternative Names
−98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNFPT 040, PT-040, PT040, Parathyroid hormone (1-34) (rat), pTH (1-34) (rat)
Similar Products
−Parathyroid Hormone-Related Protein (1-34), human/rat [orb321698]
≥95%
112540-82-6
4017.65
C180H287N57O48
2.5 mg, 1 mg, 0.5 mg

Quality Guarantee
Explore bioreagents carefree to elevate your research. All our products are rigorously tested for performance. If a product does not perform as described on its datasheet, our scientific support team will provide expert troubleshooting, a prompt replacement, or a refund. For full details, please see our Terms & Conditions and Buying Guide. Contact us at [email protected].
Documents Download
Datasheet
Product Information
Request a Document
Protocol Information
Parathyroid hormone (1-34) (rat) (orb1147058)
Based on 0 reviews
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review