You have no items in your shopping cart.
Cart summary
Item 1 of 5
Item 1 of 5
PAPSS2 Rabbit Polyclonal Antibody
Catalog Number: orb580471
| Catalog Number | orb580471 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PAPSS2 |
| Species/Host | Rabbit |
| Clonality | Polyclonal |
| Tested applications | IHC, WB |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish |
| Reactivity | Human |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PAPSS2 |
| Concentration | 0.5 mg/ml |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Conjugation | Unconjugated |
| MW | 70kDa |
| Target | PAPSS2 |
| UniProt ID | O95340 |
| Protein Sequence | Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
| NCBI | NP_001015880 |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Alternative names | SK2, BCYM4, ATPSK2 Read more... |
| Note | For research use only |
| Expiration Date | 12 months from date of receipt. |
Sample Type: Human 721_B, Antibody dilution: 1.0 ug/ml. There is BioGPS gene expression data showing that PAPSS2 is expressed in 721_B.
Sample Type: Human Hela, Antibody dilution: 1.0 ug/ml. PAPSS2 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells.
PAPSS2 antibody - C-terminal region (orb580471), Catalog Number: orb580471, Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue, Observed Staining: Cytoplasm in hepatocytes, Primary Antibody Concentration: 1:100, Other Working Concentrations: 1/600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
PAPSS2 antibody - C-terminal region (orb580471), Catalog Number: orb580471, Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue, Observed Staining: Cytoplasm of pneumocytes, Primary Antibody Concentration: 1:100, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.
WB Suggested Anti-PAPSS2 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:312500, Positive Control: 293T cell lysate.
- Item 1 of 2
- Item 1 of 1
- Item 1 of 1
PAPSS2 Rabbit Polyclonal Antibody [orb1948]
WB
Bovine, Canine, Equine, Human, Rabbit, Rat
Mouse
Rabbit
Polyclonal
Unconjugated
50 μl, 100 μl, 200 μl - Item 1 of 1
