You have no items in your shopping cart.
You have no items in your shopping cart.
| Catalog Number | orb330824 |
|---|---|
| Category | Antibodies |
| Description | Rabbit polyclonal antibody to PAFAH1B1 |
| Target | PAFAH1B1 |
| Clonality | Polyclonal |
| Species/Host | Rabbit |
| Conjugation | Unconjugated |
| Reactivity | Human, Mouse |
| Predicted Reactivity | Bovine, Canine, Equine, Guinea pig, Rabbit, Rat, Zebrafish |
| Form/Appearance | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Concentration | 0.5 mg/ml |
| Buffer/Preservatives | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B1 |
| Protein Sequence | Synthetic peptide located within the following region: MVLSQRQRDELNRAIADYLRSNGYEEAYSVFKKEAELDVNEELDKKYAGL |
| UniProt ID | P43034 |
| MW | 47kDa |
| Tested applications | WB |
| Storage | Maintain refrigerated at 2-8°C for up to 2 weeks. For long term storage store at -20°C in small aliquots to prevent freeze-thaw cycles. |
| Alternative names | anti LIS1 antibody, anti LIS2 antibody, anti MDCR Read more... |
| Research Area | Cell Biology, Neuroscience, Stem Cell & Developmen Read more... |
| Note | For research use only |
| NCBI | NP_000421 |

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Sample Tissue: Mouse Kidney, Antibody dilution: 1 ug/ml.

Rabbit Anti-PAFAH1B1 Antibody, Catalog Number: orb330824, Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue, Observed Staining: Cytoplasmic, Primary Antibody Concentration: N/A, Other Working Concentrations: 1:600, Secondary Antibody: Donkey anti-Rabbit-Cy3, Secondary Antibody Concentration: 1:200, Magnification: 20X, Exposure Time: 0.5-2.0 sec.

WB Suggested Anti-PAFAH1B1 Antibody Titration: 0.2-1 ug/ml, ELISA Titer: 1:1562500, Positive Control: MCF7 cell lysate, There is BioGPS gene expression data showing that PAFAH1B1 is expressed in MCF7.
IF, IHC-Fr, IHC-P, WB | |
Human | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Unconjugated |
WB | |
Bovine, Canine, Equine, Guinea pig, Mouse, Rabbit, Rat, Zebrafish | |
Human | |
Rabbit | |
Polyclonal | |
Unconjugated |
IF | |
Human | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
Cy3 |
IF | |
Human | |
Human, Mouse, Rat | |
Rabbit | |
Polyclonal | |
APC |
Participating in our Biorbyt product reviews program enables you to support fellow scientists by sharing your firsthand experience with our products.
Login to Submit a Review